SCOPe 2.04: Domain d1m5ta_: 1m5t A:

Lineage for d1m5ta_ (1m5t A:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.1: CheY-like [52172] (8 families)

5. Family c.23.1.1: CheY-related [52173] (26 proteins)

6. Protein Cell division response regulator DivK [82342] (1 species)

7. Species Caulobacter crescentus [TaxId:155892] [82343] (5 PDB entries)

8. Domain d1m5ta_: 1m5t A: [78660]

Details for d1m5ta_

PDB Entry: 1m5t, 1.6 Å

PDB Description: crystal structure of the response regulator divk

PDB Compounds: (A:) cell division response regulator DivK

SCOPe Domain Sequences for d1m5ta_:

Sequence; same for both SEQRES and ATOM records:

>d1m5ta_ c.23.1.1 (A:) Cell division response regulator DivK {Caulobacter crescentus [TaxId: 155892]}
tkkvlivednelnmklfhdlleaqgyetlqtreglsalsiarenkpdlilmdiqlpeisg
levtkwlkedddlahipvvavtafamkgdeerireggceayiskpisvvhfletikrlle
rqp

Timeline for d1m5ta_:

• d1m5ta_ first appeared in SCOP 1.63
  
• d1m5ta_ appears in SCOPe 2.03
  
• d1m5ta_ appears in SCOPe 2.05
  
• d1m5ta_ appears in the current release, SCOPe 2.08