Class c: Alpha and beta proteins (a/b) [51349] (117 folds) |
Fold c.23: Flavodoxin-like [52171] (16 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.1: CheY-like [52172] (5 families) |
Family c.23.1.1: CheY-related [52173] (12 proteins) |
Protein Cell division response regulator DivK [82342] (1 species) |
Species Caulobacter crescentus [TaxId:155892] [82343] (5 PDB entries) |
Domain d1m5ta_: 1m5t A: [78660] |
PDB Entry: 1m5t (more details), 1.6 Å
SCOP Domain Sequences for d1m5ta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1m5ta_ c.23.1.1 (A:) Cell division response regulator DivK {Caulobacter crescentus} tkkvlivednelnmklfhdlleaqgyetlqtreglsalsiarenkpdlilmdiqlpeisg levtkwlkedddlahipvvavtafamkgdeerireggceayiskpisvvhfletikrlle rqp
Timeline for d1m5ta_: