Lineage for d1m5ra_ (1m5r A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2910507Fold c.87: UDP-Glycosyltransferase/glycogen phosphorylase [53755] (1 superfamily)
    consists of two non-similar domains with 3 layers (a/b/a) each
    domain 1: parallel beta-sheet of 7 strands, order 3214567
    domain 2: parallel beta-sheet of 6 strands, order 321456
  4. 2910508Superfamily c.87.1: UDP-Glycosyltransferase/glycogen phosphorylase [53756] (14 families) (S)
  5. 2910509Family c.87.1.1: beta-Glucosyltransferase (DNA-modifying) [53757] (1 protein)
  6. 2910510Protein beta-Glucosyltransferase (DNA-modifying) [53758] (1 species)
  7. 2910511Species Bacteriophage T4 [TaxId:10665] [53759] (20 PDB entries)
    Uniprot P04547
  8. 2910517Domain d1m5ra_: 1m5r A: [78658]
    protein/DNA complex; complexed with mpd, trs, udp

Details for d1m5ra_

PDB Entry: 1m5r (more details), 1.8 Å

PDB Description: Ternary complex of T4 phage BGT with UDP and a 13 mer DNA duplex
PDB Compounds: (A:) DNA beta-glucosyltransferase

SCOPe Domain Sequences for d1m5ra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m5ra_ c.87.1.1 (A:) beta-Glucosyltransferase (DNA-modifying) {Bacteriophage T4 [TaxId: 10665]}
mkiaiinmgnnvinfktvpssetiylfkvisemglnvdiislkngvytksfdevdvndyd
rlivvnssinffggkpnlailsaqkfmakykskiyylftdirlpfsqswpnvknrpwayl
yteeellikspikvisqginldiakaahkkvdnviefeyfpieqykihmndfqlskptkk
tldviyggsfrsgqreskmveflfdtglnieffgnarekqfknpkypwtkapvftgkipm
nmvseknsqaiaaliigdknyndnfitlrvwetmasdavmlideefdtkhriindarfyv
nnraelidrvnelkhsdvlrkemlsiqhdilnktrakkaewqdafkkaidl

SCOPe Domain Coordinates for d1m5ra_:

Click to download the PDB-style file with coordinates for d1m5ra_.
(The format of our PDB-style files is described here.)

Timeline for d1m5ra_: