Class d: Alpha and beta proteins (a+b) [53931] (279 folds) |
Fold d.58: Ferredoxin-like [54861] (49 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.7: RNA-binding domain, RBD [54928] (4 families) |
Family d.58.7.1: Canonical RBD [54929] (20 proteins) |
Protein Splicesomal U1A protein [54932] (1 species) duplication: contains two domains of this fold |
Species Human (Homo sapiens) [TaxId:9606] [54933] (24 PDB entries) |
Domain d1m5pf_: 1m5p F: [78657] domain 1, complex with a ribozyme |
PDB Entry: 1m5p (more details), 2.6 Å
SCOP Domain Sequences for d1m5pf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1m5pf_ d.58.7.1 (F:) Splicesomal U1A protein {Human (Homo sapiens)} trpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifkevssa tnalrsmqgfpfydkpmriqyaktdsdiiakm
Timeline for d1m5pf_: