SCOPe 2.07: Domain d1m5of_: 1m5o F:

Lineage for d1m5of_ (1m5o F:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families)

5. Family d.58.7.1: Canonical RBD [54929] (70 proteins)
   Pfam PF00076
   Pfam PF13893

6. Protein Splicesomal U1A protein [54932] (2 species)
   duplication: contains two domains of this fold

7. Species Human (Homo sapiens) [TaxId:9606] [54933] (54 PDB entries)
   Uniprot P09012 1-97 ! Uniprot P09012 4-98 ! Uniprot P09012 1-98

8. Domain d1m5of_: 1m5o F: [78655]
   domain 1, complex with a ribozyme
   protein/RNA complex; complexed with ca

Details for d1m5of_

PDB Entry: 1m5o, 2.2 Å

PDB Description: transition state stabilization by a catalytic rna

PDB Compounds: (F:) U1 small nuclear ribonucleoprotein A

SCOPe Domain Sequences for d1m5of_:

Sequence; same for both SEQRES and ATOM records:

>d1m5of_ d.58.7.1 (F:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]}
petrpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifkevs
satnalrsmqgfpfydkpmriqyaktdsdiiakmk

Timeline for d1m5of_:

• d1m5of_ first appeared in SCOP 1.63
  
• d1m5of_ appears in SCOPe 2.06
  
• d1m5of_ appears in the current release, SCOPe 2.08