SCOP 1.69: Domain d1m5oc_: 1m5o C:

Lineage for d1m5oc_ (1m5o C:)

1. Root: SCOP 1.69

2. Class d: Alpha and beta proteins (a+b) [53931] (279 folds)

3. Fold d.58: Ferredoxin-like [54861] (49 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.7: RNA-binding domain, RBD [54928] (4 families)

5. Family d.58.7.1: Canonical RBD [54929] (20 proteins)

6. Protein Splicesomal U1A protein [54932] (1 species)
   duplication: contains two domains of this fold

7. Species Human (Homo sapiens) [TaxId:9606] [54933] (24 PDB entries)

8. Domain d1m5oc_: 1m5o C: [78654]

Details for d1m5oc_

PDB Entry: 1m5o, 2.2 Å

PDB Description: transition state stabilization by a catalytic rna

SCOP Domain Sequences for d1m5oc_:

Sequence; same for both SEQRES and ATOM records:

>d1m5oc_ d.58.7.1 (C:) Splicesomal U1A protein {Human (Homo sapiens)}
trpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifkevssa
tnalrsmqgfpfydkpmriqyaktdsdiiakm

Timeline for d1m5oc_:

• d1m5oc_ first appeared in SCOP 1.63
  
• d1m5oc_ appears in SCOP 1.67
  
• d1m5oc_ appears in SCOP 1.71
  
• d1m5oc_ appears in the current release, SCOPe 2.08