Lineage for d1m5ns_ (1m5n S:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2725421Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2725422Superfamily a.118.1: ARM repeat [48371] (28 families) (S)
  5. 2725423Family a.118.1.1: Armadillo repeat [48372] (7 proteins)
    this is a repeat family; one repeat unit is 1ee4 A:288-330 found in domain
  6. 2725501Protein Importin beta [48378] (3 species)
  7. 2725504Species Human (Homo sapiens) [TaxId:9606] [48379] (11 PDB entries)
  8. 2725520Domain d1m5ns_: 1m5n S: [78653]
    bound to the non-classical nls(67-94) of pthrp, chain Q
    applies to all domains of a family if the common domain is composed of a different number of small repeating units

Details for d1m5ns_

PDB Entry: 1m5n (more details), 2.9 Å

PDB Description: Crystal structure of HEAT repeats (1-11) of importin b bound to the non-classical NLS(67-94) of PTHrP
PDB Compounds: (S:) importin beta-1 subunit

SCOPe Domain Sequences for d1m5ns_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m5ns_ a.118.1.1 (S:) Importin beta {Human (Homo sapiens) [TaxId: 9606]}
melitilektvspdrleleaaqkfleraavenlptflvelsrvlanpgnsqvarvaaglq
iknsltskdpdikaqyqqrwlaidanarrevknyvlqtlgtetyrpssasqcvagiacae
ipvnqwpelipqlvanvtnpnstehmkestleaigyicqdidpeqlqdksneiltaiiqg
mrkeepsnnvklaatnallnsleftkanfdkeserhfimqvvceatqcpdtrvrvaalqn
lvkimslyyqymetymgpalfaitieamksdidevalqgiefwsnvcdeemdlaieasea
aeqgrppehtskfyakgalqylvpiltqtltkqdendddddwnpckaagvclmllatcce
ddivphvlpfikehiknpdwryrdaavmafgcilegpepsqlkplviqamptlielmkdp
svvvrdtaawtvgricellpeaaindvylapllqclieglsaeprvasnvcwafsslaea
ayeaa

SCOPe Domain Coordinates for d1m5ns_:

Click to download the PDB-style file with coordinates for d1m5ns_.
(The format of our PDB-style files is described here.)

Timeline for d1m5ns_: