Lineage for d1m5ia_ (1m5i A:)

  1. Root: SCOP 1.63
  2. 271841Class h: Coiled coil proteins [57942] (6 folds)
  3. 272641Fold h.4: Antiparallel coiled-coil [58086] (13 superfamilies)
    this is not a true fold; contains at least two very long antiparallel helices
  4. 272733Superfamily h.4.13: Tumor suppressor gene product Apc [82931] (1 family) (S)
  5. 272734Family h.4.13.1: Tumor suppressor gene product Apc [82932] (1 protein)
  6. 272735Protein Tumor suppressor gene product Apc [82933] (1 species)
  7. 272736Species Human (Homo sapiens) [TaxId:9606] [82934] (1 PDB entry)
  8. 272737Domain d1m5ia_: 1m5i A: [78648]

Details for d1m5ia_

PDB Entry: 1m5i (more details), 2 Å

PDB Description: Crystal Structure of the coiled coil region 129-250 of the tumor suppressor gene product APC

SCOP Domain Sequences for d1m5ia_:

Sequence, based on SEQRES records: (download)

>d1m5ia_ h.4.13.1 (A:) Tumor suppressor gene product Apc {Human (Homo sapiens)}
stgyleelekersllladldkeekekdwyyaqlqnltkridslpltenfslqtdmtrrql
eyearqirvameeqlgtcqdmekraqrriariqqiekdilrirqllqsqa

Sequence, based on observed residues (ATOM records): (download)

>d1m5ia_ h.4.13.1 (A:) Tumor suppressor gene product Apc {Human (Homo sapiens)}
stgyleelekersllladldkeekekdwyyaqlqnltkridslpslqtdmtrrqleyear
qirvameeqlgtcqdmekraqrriariqqiekdilrirqllqsqa

SCOP Domain Coordinates for d1m5ia_:

Click to download the PDB-style file with coordinates for d1m5ia_.
(The format of our PDB-style files is described here.)

Timeline for d1m5ia_: