SCOP 1.63: Domain d1m5da_: 1m5d A:

Lineage for d1m5da_ (1m5d A:)

1. Root: SCOP 1.63

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (2 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (19 proteins)

6. Protein Glutamate receptor ligand binding core [53881] (2 species)

7. Species Rat (Rattus norvegicus), GluR2 [TaxId:10116] [53882] (18 PDB entries)

8. Domain d1m5da_: 1m5d A: [78641]
   complexed with brh, so4; mutant

Details for d1m5da_

PDB Entry: 1m5d, 1.73 Å

PDB Description: x-ray structure of the glur2 ligand binding core (s1s2j-y702f) in complex with br-hibo at 1.73 a resolution

SCOP Domain Sequences for d1m5da_:

Sequence; same for both SEQRES and ATOM records:

>d1m5da_ c.94.1.1 (A:) Glutamate receptor ligand binding core {Rat (Rattus norvegicus), GluR2}
ktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgkyga
rdadtkiwngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkgtpies
aedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvarvrk
skgkyafllestmneyieqrkpcdtmkvggnldskgygiatpkgsslgnavnlavlklne
qglldklknkwwydkgec

Timeline for d1m5da_:

• d1m5da_ is new in SCOP 1.63
  
• d1m5da_ appears in SCOP 1.65
  
• d1m5da_ appears in the current release, SCOPe 2.08