| Class c: Alpha and beta proteins (a/b) [51349] (117 folds) |
| Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (2 families) ![]() Similar in architecture to the superfamily I but partly differs in topology |
| Family c.94.1.1: Phosphate binding protein-like [53851] (19 proteins) |
| Protein Glutamate receptor ligand binding core [53881] (2 species) |
| Species Rat (Rattus norvegicus), GluR2 [TaxId:10116] [53882] (18 PDB entries) |
| Domain d1m5ca_: 1m5c A: [78640] complexed with brh |
PDB Entry: 1m5c (more details), 1.65 Å
SCOP Domain Sequences for d1m5ca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1m5ca_ c.94.1.1 (A:) Glutamate receptor ligand binding core {Rat (Rattus norvegicus), GluR2}
ktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgkyga
rdadtkiwngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkgtpies
aedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvarvrk
skgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslgnavnlavlklne
qglldklknkwwydkgec
Timeline for d1m5ca_: