Lineage for d1m58a_ (1m58 A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1890050Fold d.5: RNase A-like [54075] (1 superfamily)
    contains long curved beta-sheet and 3 helices
  4. 1890051Superfamily d.5.1: RNase A-like [54076] (2 families) (S)
    can be classified as disulfide-rich
  5. 1890052Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins)
  6. 1890053Protein Amphibian cytotoxic ribonuclease [54084] (5 species)
  7. 1890060Species Bullfrog (Rana catesbeiana), RNase2 [TaxId:8400] [82571] (1 PDB entry)
  8. 1890061Domain d1m58a_: 1m58 A: [78636]

Details for d1m58a_

PDB Entry: 1m58 (more details)

PDB Description: solution structure of cytotoxic rc-rnase2
PDB Compounds: (A:) RC-RNase2 ribonuclease

SCOPe Domain Sequences for d1m58a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m58a_ d.5.1.1 (A:) Amphibian cytotoxic ribonuclease {Bullfrog (Rana catesbeiana), RNase2 [TaxId: 8400]}
mqnwetfqkkhltdtrdvkcdaemkkalfdckqkntfiyarpgrvqalckniivsknvls
tdefylsdcnriklpchyklkkssnticitcenklpvhfvaveecp

SCOPe Domain Coordinates for d1m58a_:

Click to download the PDB-style file with coordinates for d1m58a_.
(The format of our PDB-style files is described here.)

Timeline for d1m58a_: