![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.5: RNase A-like [54075] (1 superfamily) contains long curved beta-sheet and 3 helices |
![]() | Superfamily d.5.1: RNase A-like [54076] (2 families) ![]() can be classified as disulfide-rich |
![]() | Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins) |
![]() | Protein Amphibian cytotoxic ribonuclease [54084] (5 species) |
![]() | Species Bullfrog (Rana catesbeiana), RNase2 [TaxId:8400] [82571] (1 PDB entry) |
![]() | Domain d1m58a_: 1m58 A: [78636] |
PDB Entry: 1m58 (more details)
SCOPe Domain Sequences for d1m58a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1m58a_ d.5.1.1 (A:) Amphibian cytotoxic ribonuclease {Bullfrog (Rana catesbeiana), RNase2 [TaxId: 8400]} mqnwetfqkkhltdtrdvkcdaemkkalfdckqkntfiyarpgrvqalckniivsknvls tdefylsdcnriklpchyklkkssnticitcenklpvhfvaveecp
Timeline for d1m58a_: