SCOP 1.65: Domain d1m58a_: 1m58 A:

Lineage for d1m58a_ (1m58 A:)

1. Root: SCOP 1.65

2. Class d: Alpha and beta proteins (a+b) [53931] (234 folds)

3. Fold d.5: RNase A-like [54075] (1 superfamily)
   contains long curved beta-sheet and 3 helices

4. Superfamily d.5.1: RNase A-like [54076] (1 family)
   can be classified as disulphide-rich

5. Family d.5.1.1: Ribonuclease A-like [54077] (8 proteins)

6. Protein Amphibian cytotoxic ribonuclease [54084] (4 species)

7. Species Bullfrog (Rana catesbeiana), RNase2 [TaxId:8400] [82571] (1 PDB entry)

8. Domain d1m58a_: 1m58 A: [78636]
   mutant

Details for d1m58a_

PDB Entry: 1m58

PDB Description: solution structure of cytotoxic rc-rnase2

SCOP Domain Sequences for d1m58a_:

Sequence; same for both SEQRES and ATOM records:

>d1m58a_ d.5.1.1 (A:) Amphibian cytotoxic ribonuclease {Bullfrog (Rana catesbeiana), RNase2}
mqnwetfqkkhltdtrdvkcdaemkkalfdckqkntfiyarpgrvqalckniivsknvls
tdefylsdcnriklpchyklkkssnticitcenklpvhfvaveecp

Timeline for d1m58a_:

• d1m58a_ first appeared in SCOP 1.63
  
• d1m58a_ appears in SCOP 1.67
  
• d1m58a_ appears in the current release, SCOPe 2.08