Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins) members organized in the groups and subfamiles specified by the comments |
Protein Abelsone tyrosine kinase (abl) [56166] (2 species) PTK group; Abl subfamily; non-membrane spanning protein tyrosine kinase |
Domain d1m52b_: 1m52 B: [78635] complexed with mes, p17 |
PDB Entry: 1m52 (more details), 2.6 Å
SCOPe Domain Sequences for d1m52b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1m52b_ d.144.1.7 (B:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} ydkwemertditmkhklgggqygevyegvwkkysltvavktlkedtmeveeflkeaavmk eikhpnlvqllgvctreppfyiitefmtygnlldylrecnrqevsavvllymatqissam eylekknfihrdlaarnclvgenhlvkvadfglsrlmtgdtytahagakfpikwtapesl aynkfsiksdvwafgvllweiatygmspypgidlsqvyellekdyrmerpegcpekvyel mracwqwnpsdrpsfaeihqafetmfqessis
Timeline for d1m52b_: