SCOP 1.63: Domain d1m52b_: 1m52 B:

Lineage for d1m52b_ (1m52 B:)

1. Root: SCOP 1.63

2. Class d: Alpha and beta proteins (a+b) [53931] (224 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (6 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.2: Tyrosine kinase [56150] (15 proteins)

6. Protein Abelsone tyrosine kinase (abl) [56166] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [56167] (3 PDB entries)

8. Domain d1m52b_: 1m52 B: [78635]
   complexed with mes, p17

Details for d1m52b_

PDB Entry: 1m52, 2.6 Å

PDB Description: Crystal Structure of the c-Abl Kinase domain in complex with PD173955

SCOP Domain Sequences for d1m52b_:

Sequence; same for both SEQRES and ATOM records:

>d1m52b_ d.144.1.2 (B:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus)}
ydkwemertditmkhklgggqygevyegvwkkysltvavktlkedtmeveeflkeaavmk
eikhpnlvqllgvctreppfyiitefmtygnlldylrecnrqevsavvllymatqissam
eylekknfihrdlaarnclvgenhlvkvadfglsrlmtgdtytahagakfpikwtapesl
aynkfsiksdvwafgvllweiatygmspypgidlsqvyellekdyrmerpegcpekvyel
mracwqwnpsdrpsfaeihqafetmfqessis

Timeline for d1m52b_:

• d1m52b_ is new in SCOP 1.63
  
• d1m52b_ appears in SCOP 1.65
  
• d1m52b_ appears in the current release, SCOPe 2.08