Lineage for d1m52a_ (1m52 A:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 734668Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 734669Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 734710Family d.144.1.7: Protein kinases, catalytic subunit [88854] (61 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 734725Protein Abelsone tyrosine kinase (abl) [56166] (1 species)
    PTK group; Abl subfamily; non-membrane spanning protein tyrosine kinase
  7. 734726Species Mouse (Mus musculus) [TaxId:10090] [56167] (8 PDB entries)
  8. 734735Domain d1m52a_: 1m52 A: [78634]

Details for d1m52a_

PDB Entry: 1m52 (more details), 2.6 Å

PDB Description: Crystal Structure of the c-Abl Kinase domain in complex with PD173955
PDB Compounds: (A:) Proto-oncogene tyrosine-protein kinase ABL1

SCOP Domain Sequences for d1m52a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m52a_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]}
ydkwemertditmkhklgggqygevyegvwkkysltvavktlkedtmeveeflkeaavmk
eikhpnlvqllgvctreppfyiitefmtygnlldylrecnrqevsavvllymatqissam
eylekknfihrdlaarnclvgenhlvkvadfglsrlmtgdtytahagakfpikwtapesl
aynkfsiksdvwafgvllweiatygmspypgidlsqvyellekdyrmerpegcpekvyel
mracwqwnpsdrpsfaeihqafetmfqessi

SCOP Domain Coordinates for d1m52a_:

Click to download the PDB-style file with coordinates for d1m52a_.
(The format of our PDB-style files is described here.)

Timeline for d1m52a_: