Lineage for d1m52a_ (1m52 A:)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 262793Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 262794Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (6 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 263016Family d.144.1.2: Tyrosine kinase [56150] (15 proteins)
  6. 263017Protein Abelsone tyrosine kinase (abl) [56166] (1 species)
  7. 263018Species Mouse (Mus musculus) [TaxId:10090] [56167] (3 PDB entries)
  8. 263023Domain d1m52a_: 1m52 A: [78634]

Details for d1m52a_

PDB Entry: 1m52 (more details), 2.6 Å

PDB Description: Crystal Structure of the c-Abl Kinase domain in complex with PD173955

SCOP Domain Sequences for d1m52a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m52a_ d.144.1.2 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus)}
ydkwemertditmkhklgggqygevyegvwkkysltvavktlkedtmeveeflkeaavmk
eikhpnlvqllgvctreppfyiitefmtygnlldylrecnrqevsavvllymatqissam
eylekknfihrdlaarnclvgenhlvkvadfglsrlmtgdtytahagakfpikwtapesl
aynkfsiksdvwafgvllweiatygmspypgidlsqvyellekdyrmerpegcpekvyel
mracwqwnpsdrpsfaeihqafetmfqessi

SCOP Domain Coordinates for d1m52a_:

Click to download the PDB-style file with coordinates for d1m52a_.
(The format of our PDB-style files is described here.)

Timeline for d1m52a_: