Lineage for d1m4zb_ (1m4z B:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1783288Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 1785089Superfamily b.34.12: BAH domain [82061] (2 families) (S)
  5. 1785090Family b.34.12.1: BAH domain [82062] (2 proteins)
  6. 1785102Protein Origin-recognition complex protein 120kDa subunit, Orc1p [82063] (1 species)
  7. 1785103Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82064] (3 PDB entries)
  8. 1785105Domain d1m4zb_: 1m4z B: [78631]
    complexed with mn

Details for d1m4zb_

PDB Entry: 1m4z (more details), 2.2 Å

PDB Description: crystal structure of the n-terminal bah domain of orc1p
PDB Compounds: (B:) Origin recognition complex subunit 1

SCOPe Domain Sequences for d1m4zb_:

Sequence, based on SEQRES records: (download)

>d1m4zb_ b.34.12.1 (B:) Origin-recognition complex protein 120kDa subunit, Orc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mtmaktlkdlqgweiittdeqgniidggqkrlrrrgaktehylkrssdgiklgrgdsvvm
hneaagtysvymiqelrlntlnnvvelwaltylrwfevnplahyrqfnpdanilnrplny
ynklfsetanknelyltaelaelqlfnfirvanvmdgskwevlkgnvdperdftvryice
ptgekfvdiniedvkayikkvepreaqeylkdltlps

Sequence, based on observed residues (ATOM records): (download)

>d1m4zb_ b.34.12.1 (B:) Origin-recognition complex protein 120kDa subunit, Orc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mtmaktlkdlqgweiittdeqgnitehylkrssdgiklgrgdsvvmhneaagtysvymiq
elrlntlnnvvelwaltylrwfevnplahyrqfnpdanilnrplnyynklfsetanknel
yltaelaelqlfnfirvanvmdgskwevlkgnvdperdftvryiceptgekfvdiniedv
kayikkvepreaqeylkdltlps

SCOPe Domain Coordinates for d1m4zb_:

Click to download the PDB-style file with coordinates for d1m4zb_.
(The format of our PDB-style files is described here.)

Timeline for d1m4zb_: