Lineage for d1m4za1 (1m4z A:1-214)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2053585Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2055508Superfamily b.34.12: BAH domain [82061] (2 families) (S)
  5. 2055509Family b.34.12.1: BAH domain [82062] (2 proteins)
  6. 2055525Protein Origin-recognition complex protein 120kDa subunit, Orc1p [82063] (1 species)
  7. 2055526Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82064] (3 PDB entries)
  8. 2055527Domain d1m4za1: 1m4z A:1-214 [78630]
    Other proteins in same PDB: d1m4za2, d1m4zb2
    complexed with mn

Details for d1m4za1

PDB Entry: 1m4z (more details), 2.2 Å

PDB Description: crystal structure of the n-terminal bah domain of orc1p
PDB Compounds: (A:) Origin recognition complex subunit 1

SCOPe Domain Sequences for d1m4za1:

Sequence, based on SEQRES records: (download)

>d1m4za1 b.34.12.1 (A:1-214) Origin-recognition complex protein 120kDa subunit, Orc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
maktlkdlqgweiittdeqgniidggqkrlrrrgaktehylkrssdgiklgrgdsvvmhn
eaagtysvymiqelrlntlnnvvelwaltylrwfevnplahyrqfnpdanilnrplnyyn
klfsetanknelyltaelaelqlfnfirvanvmdgskwevlkgnvdperdftvryicept
gekfvdiniedvkayikkvepreaqeylkdltlp

Sequence, based on observed residues (ATOM records): (download)

>d1m4za1 b.34.12.1 (A:1-214) Origin-recognition complex protein 120kDa subunit, Orc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
maktlkdlqgweiittdeqgnitehylkrssdgiklgrgdsvvmhneaagtysvymiqel
rlntlnnvvelwaltylrwfevnplahyrqfnpdanilnrplnyynklfsetanknelyl
taelaelqlfnfirvanvmdgskwevlkgnvdperdftvryiceptgekfvdiniedvka
yikkvepreaqeylkdltlp

SCOPe Domain Coordinates for d1m4za1:

Click to download the PDB-style file with coordinates for d1m4za1.
(The format of our PDB-style files is described here.)

Timeline for d1m4za1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1m4za2