Lineage for d1m4ul_ (1m4u L:)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2260390Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
    disulfide-rich fold; common core is all-beta
  4. 2260391Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families) (S)
  5. 2260482Family g.17.1.2: Transforming growth factor (TGF)-beta [57507] (8 proteins)
  6. 2260527Protein Bone morphogenetic protein-7 (BMP-7) [57514] (1 species)
  7. 2260528Species Human (Homo sapiens) [TaxId:9606] [57515] (4 PDB entries)
  8. 2260530Domain d1m4ul_: 1m4u L: [78626]
    Other proteins in same PDB: d1m4ua_

Details for d1m4ul_

PDB Entry: 1m4u (more details), 2.42 Å

PDB Description: crystal structure of bone morphogenetic protein-7 (bmp-7) in complex with the secreted antagonist noggin
PDB Compounds: (L:) bone morphogenetic protein-7

SCOPe Domain Sequences for d1m4ul_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m4ul_ g.17.1.2 (L:) Bone morphogenetic protein-7 (BMP-7) {Human (Homo sapiens) [TaxId: 9606]}
ensssdqrqackkhelyvsfrdlgwqdwiiapegyaayycegecafplnsymnatnhaiv
qtlvhfinpetvpkpccaptqlnaisvlyfddssnvilkkyrnmvvracgch

SCOPe Domain Coordinates for d1m4ul_:

Click to download the PDB-style file with coordinates for d1m4ul_.
(The format of our PDB-style files is described here.)

Timeline for d1m4ul_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1m4ua_