Lineage for d1m4ul_ (1m4u L:)

  1. Root: SCOP 1.65
  2. 341323Class g: Small proteins [56992] (66 folds)
  3. 343283Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
    disulphide-rich fold; common core is all-beta
  4. 343284Superfamily g.17.1: Cystine-knot cytokines [57501] (7 families) (S)
  5. 343331Family g.17.1.2: Transforming growth factor (TGF)-beta [57507] (7 proteins)
  6. 343343Protein Bone morphogenetic protein-7 (BMP-7) [57514] (1 species)
  7. 343344Species Human (Homo sapiens) [TaxId:9606] [57515] (4 PDB entries)
  8. 343346Domain d1m4ul_: 1m4u L: [78626]
    Other proteins in same PDB: d1m4ua_
    complexed with nag

Details for d1m4ul_

PDB Entry: 1m4u (more details), 2.42 Å

PDB Description: crystal structure of bone morphogenetic protein-7 (bmp-7) in complex with the secreted antagonist noggin

SCOP Domain Sequences for d1m4ul_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m4ul_ g.17.1.2 (L:) Bone morphogenetic protein-7 (BMP-7) {Human (Homo sapiens)}
ensssdqrqackkhelyvsfrdlgwqdwiiapegyaayycegecafplnsymnatnhaiv
qtlvhfinpetvpkpccaptqlnaisvlyfddssnvilkkyrnmvvracgch

SCOP Domain Coordinates for d1m4ul_:

Click to download the PDB-style file with coordinates for d1m4ul_.
(The format of our PDB-style files is described here.)

Timeline for d1m4ul_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1m4ua_