![]() | Class g: Small proteins [56992] (61 folds) |
![]() | Fold g.17: Cystine-knot cytokines [57500] (1 superfamily) disulphide-rich fold; common core is all-beta |
![]() | Superfamily g.17.1: Cystine-knot cytokines [57501] (7 families) ![]() |
![]() | Family g.17.1.2: Transforming growth factor (TGF)-beta [57507] (6 proteins) |
![]() | Protein Bone morphogenetic protein-7 (BMP-7) [57514] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [57515] (2 PDB entries) |
![]() | Domain d1m4ul_: 1m4u L: [78626] Other proteins in same PDB: d1m4ua_ complexed with nag |
PDB Entry: 1m4u (more details), 2.42 Å
SCOP Domain Sequences for d1m4ul_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1m4ul_ g.17.1.2 (L:) Bone morphogenetic protein-7 (BMP-7) {Human (Homo sapiens)} ensssdqrqackkhelyvsfrdlgwqdwiiapegyaayycegecafplnsymnatnhaiv qtlvhfinpetvpkpccaptqlnaisvlyfddssnvilkkyrnmvvracgch
Timeline for d1m4ul_: