SCOP 1.63: Domain d1m4ul_: 1m4u L:

Lineage for d1m4ul_ (1m4u L:)

1. Root: SCOP 1.63

2. Class g: Small proteins [56992] (61 folds)

3. Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
   disulphide-rich fold; common core is all-beta

4. Superfamily g.17.1: Cystine-knot cytokines [57501] (7 families)

5. Family g.17.1.2: Transforming growth factor (TGF)-beta [57507] (6 proteins)

6. Protein Bone morphogenetic protein-7 (BMP-7) [57514] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57515] (2 PDB entries)

8. Domain d1m4ul_: 1m4u L: [78626]
   Other proteins in same PDB: d1m4ua_
   complexed with nag

Details for d1m4ul_

PDB Entry: 1m4u, 2.42 Å

PDB Description: crystal structure of bone morphogenetic protein-7 (bmp-7) in complex with the secreted antagonist noggin

SCOP Domain Sequences for d1m4ul_:

Sequence; same for both SEQRES and ATOM records:

>d1m4ul_ g.17.1.2 (L:) Bone morphogenetic protein-7 (BMP-7) {Human (Homo sapiens)}
ensssdqrqackkhelyvsfrdlgwqdwiiapegyaayycegecafplnsymnatnhaiv
qtlvhfinpetvpkpccaptqlnaisvlyfddssnvilkkyrnmvvracgch

Timeline for d1m4ul_:

• d1m4ul_ is new in SCOP 1.63
  
• d1m4ul_ appears in SCOP 1.65
  
• d1m4ul_ appears in the current release, SCOPe 2.08