Lineage for d1m4ua_ (1m4u A:)

  1. Root: SCOP 1.63
  2. 268577Class g: Small proteins [56992] (61 folds)
  3. 270434Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
    disulphide-rich fold; common core is all-beta
  4. 270435Superfamily g.17.1: Cystine-knot cytokines [57501] (7 families) (S)
  5. 270573Family g.17.1.7: Noggin [82904] (1 protein)
  6. 270574Protein Noggin [82905] (1 species)
    BMP-7 antagonist
  7. 270575Species Human (Homo sapiens) [TaxId:9606] [82906] (1 PDB entry)
  8. 270576Domain d1m4ua_: 1m4u A: [78625]
    Other proteins in same PDB: d1m4ul_
    complexed with nag

Details for d1m4ua_

PDB Entry: 1m4u (more details), 2.42 Å

PDB Description: crystal structure of bone morphogenetic protein-7 (bmp-7) in complex with the secreted antagonist noggin

SCOP Domain Sequences for d1m4ua_:

Sequence, based on SEQRES records: (download)

>d1m4ua_ g.17.1.7 (A:) Noggin {Human (Homo sapiens)}
mqhylhirpapsdnlplvdliehpdpifdpkekdlnetllrsllgghydpgfmatspped
rpgggggaaggaedlaeldqllrqrpsgampseikglefseglaqgkkqrlskklrrklq
mwlwsqtfcpvlyawndlgsrfwpryvkvgscfskrscsvpegmvckpsksvhltvlrwr
cqrrggqrcgwipiqypiiseckcsc

Sequence, based on observed residues (ATOM records): (download)

>d1m4ua_ g.17.1.7 (A:) Noggin {Human (Homo sapiens)}
mqhylhirpapsdnlplvdliehpdpifdpkekdlnetllrsllgghydpgfmatspped
rpggaedlaeldqllrqrpsgampseikglefseglaqgkkqrlskklrrklqmwlwsqt
fcpvlyawndlgsrfwpryvkvgscfskrscsvpegmvckpsksvhltvlrwrcqrrggq
rcgwipiqypiiseckcsc

SCOP Domain Coordinates for d1m4ua_:

Click to download the PDB-style file with coordinates for d1m4ua_.
(The format of our PDB-style files is described here.)

Timeline for d1m4ua_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1m4ul_