Lineage for d1m4ua1 (1m4u A:28-232)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3033576Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
    disulfide-rich fold; common core is all-beta
  4. 3033577Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families) (S)
  5. 3033928Family g.17.1.7: Noggin [82904] (1 protein)
    automatically mapped to Pfam PF05806
  6. 3033929Protein Noggin [82905] (1 species)
    BMP-7 antagonist
  7. 3033930Species Human (Homo sapiens) [TaxId:9606] [82906] (1 PDB entry)
  8. 3033931Domain d1m4ua1: 1m4u A:28-232 [78625]
    Other proteins in same PDB: d1m4ua2, d1m4ul_

Details for d1m4ua1

PDB Entry: 1m4u (more details), 2.42 Å

PDB Description: crystal structure of bone morphogenetic protein-7 (bmp-7) in complex with the secreted antagonist noggin
PDB Compounds: (A:) Noggin

SCOPe Domain Sequences for d1m4ua1:

Sequence, based on SEQRES records: (download)

>d1m4ua1 g.17.1.7 (A:28-232) Noggin {Human (Homo sapiens) [TaxId: 9606]}
qhylhirpapsdnlplvdliehpdpifdpkekdlnetllrsllgghydpgfmatsppedr
pgggggaaggaedlaeldqllrqrpsgampseikglefseglaqgkkqrlskklrrklqm
wlwsqtfcpvlyawndlgsrfwpryvkvgscfskrscsvpegmvckpsksvhltvlrwrc
qrrggqrcgwipiqypiiseckcsc

Sequence, based on observed residues (ATOM records): (download)

>d1m4ua1 g.17.1.7 (A:28-232) Noggin {Human (Homo sapiens) [TaxId: 9606]}
qhylhirpapsdnlplvdliehpdpifdpkekdlnetllrsllgghydpgfmatsppedr
pggaedlaeldqllrqrpsgampseikglefseglaqgkkqrlskklrrklqmwlwsqtf
cpvlyawndlgsrfwpryvkvgscfskrscsvpegmvckpsksvhltvlrwrcqrrggqr
cgwipiqypiiseckcsc

SCOPe Domain Coordinates for d1m4ua1:

Click to download the PDB-style file with coordinates for d1m4ua1.
(The format of our PDB-style files is described here.)

Timeline for d1m4ua1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1m4ua2
View in 3D
Domains from other chains:
(mouse over for more information)
d1m4ul_