Class c: Alpha and beta proteins (a/b) [51349] (130 folds) |
Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
Superfamily c.95.1: Thiolase-like [53901] (2 families) |
Family c.95.1.1: Thiolase-related [53902] (6 proteins) |
Protein Biosynthetic thiolase [53905] (1 species) |
Species Zoogloea ramigera [TaxId:350] [53906] (11 PDB entries) |
Domain d1m4sd1: 1m4s D:1-268 [78615] |
PDB Entry: 1m4s (more details), 1.87 Å
SCOP Domain Sequences for d1m4sd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1m4sd1 c.95.1.1 (D:1-268) Biosynthetic thiolase {Zoogloea ramigera} stpsiviasaartavgsfngafantpahelgatvisavleragvaagevnevilgqvlpa gegqnparqaamkagvpqeatawgmnqlcgsglravalgmqqiatgdasiivaggmesms maphcahlrggvkmgdfkmidtmikdgltdafygyhmgttaenvakqwqlsrdeqdafav asqnkaeaaqkdgrfkdeivpfivkgrkgditvdadeyirhgatldsmaklrpafdkegt vtagnasglndgaaaallmseaeasrrg
Timeline for d1m4sd1: