| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
Superfamily c.95.1: Thiolase-like [53901] (3 families) ![]() |
| Family c.95.1.1: Thiolase-related [53902] (20 proteins) |
| Protein Biosynthetic thiolase, N-terminal domain [419020] (1 species) |
| Species Zoogloea ramigera [TaxId:350] [419502] (16 PDB entries) Uniprot P07097 |
| Domain d1m4sd1: 1m4s D:1-268 [78615] Other proteins in same PDB: d1m4sa2, d1m4sb2, d1m4sc2, d1m4sd2 complexed with gol, so4 has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1m4s (more details), 1.87 Å
SCOPe Domain Sequences for d1m4sd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1m4sd1 c.95.1.1 (D:1-268) Biosynthetic thiolase, N-terminal domain {Zoogloea ramigera [TaxId: 350]}
stpsiviasaartavgsfngafantpahelgatvisavleragvaagevnevilgqvlpa
gegqnparqaamkagvpqeatawgmnqlcgsglravalgmqqiatgdasiivaggmesms
maphcahlrggvkmgdfkmidtmikdgltdafygyhmgttaenvakqwqlsrdeqdafav
asqnkaeaaqkdgrfkdeivpfivkgrkgditvdadeyirhgatldsmaklrpafdkegt
vtagnasglndgaaaallmseaeasrrg
Timeline for d1m4sd1: