Lineage for d1m4sb2 (1m4s B:269-392)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 251049Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudodyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strands 1 & 5 are antiparallel to the rest
  4. 251050Superfamily c.95.1: Thiolase-like [53901] (2 families) (S)
  5. 251051Family c.95.1.1: Thiolase-related [53902] (6 proteins)
  6. 251111Protein Biosynthetic thiolase [53905] (1 species)
  7. 251112Species Zoogloea ramigera [TaxId:350] [53906] (10 PDB entries)
  8. 251140Domain d1m4sb2: 1m4s B:269-392 [78612]

Details for d1m4sb2

PDB Entry: 1m4s (more details), 1.87 Å

PDB Description: biosynthetic thiolase, cys89 acetylated, unliganded form

SCOP Domain Sequences for d1m4sb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m4sb2 c.95.1.1 (B:269-392) Biosynthetic thiolase {Zoogloea ramigera}
iqplgrivswatvgvdpkvmgtgpipasrkaleragwkigdldlveaneafaaqacavnk
dlgwdpsivnvnggaiaighpigasgarilntllfemkrrgarkglatlcigggmgvamc
iesl

SCOP Domain Coordinates for d1m4sb2:

Click to download the PDB-style file with coordinates for d1m4sb2.
(The format of our PDB-style files is described here.)

Timeline for d1m4sb2: