Lineage for d1m4qa_ (1m4q A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2183821Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 2183822Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 2184177Family d.20.1.2: UEV domain [75383] (3 proteins)
  6. 2184178Protein Tumor susceptibility gene 101 (TSG101) [75384] (1 species)
  7. 2184179Species Human (Homo sapiens) [TaxId:9606] [75385] (13 PDB entries)
  8. 2184193Domain d1m4qa_: 1m4q A: [78608]
    complex with a hiv-1 ptap "late domain" peptide

Details for d1m4qa_

PDB Entry: 1m4q (more details)

PDB Description: structure of the tsg101 uev domain in complex with a hiv-1 ptap "late domain" peptide, cns ensemble
PDB Compounds: (A:) Tumor susceptibility gene 101 protein

SCOPe Domain Sequences for d1m4qa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m4qa_ d.20.1.2 (A:) Tumor susceptibility gene 101 (TSG101) {Human (Homo sapiens) [TaxId: 9606]}
avsesqlkkmvskykyrdltvretvnvitlykdlkpvldsyvfndgssrelmnltgtipv
pyrgntynipiclwlldtypynppicfvkptssmtiktgkhvdangkiylpylhewkhpq
sdllgliqvmivvfgdeppvfsrp

SCOPe Domain Coordinates for d1m4qa_:

Click to download the PDB-style file with coordinates for d1m4qa_.
(The format of our PDB-style files is described here.)

Timeline for d1m4qa_: