Lineage for d1m4pa_ (1m4p A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1406945Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 1406946Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 1407195Family d.20.1.2: UEV domain [75383] (3 proteins)
  6. 1407196Protein Tumor susceptibility gene 101 (TSG101) [75384] (1 species)
  7. 1407197Species Human (Homo sapiens) [TaxId:9606] [75385] (11 PDB entries)
  8. 1407210Domain d1m4pa_: 1m4p A: [78607]
    complex with a hiv-1 ptap "late domain" peptide

Details for d1m4pa_

PDB Entry: 1m4p (more details)

PDB Description: structure of the tsg101 uev domain in complex with a hiv-1 ptap "late domain" peptide, dyana ensemble
PDB Compounds: (A:) Tumor susceptibility gene 101 protein

SCOPe Domain Sequences for d1m4pa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m4pa_ d.20.1.2 (A:) Tumor susceptibility gene 101 (TSG101) {Human (Homo sapiens) [TaxId: 9606]}
avsesqlkkmvskykyrdltvretvnvitlykdlkpvldsyvfndgssrelmnltgtipv
pyrgntynipiclwlldtypynppicfvkptssmtiktgkhvdangkiylpylhewkhpq
sdllgliqvmivvfgdeppvfsrp

SCOPe Domain Coordinates for d1m4pa_:

Click to download the PDB-style file with coordinates for d1m4pa_.
(The format of our PDB-style files is described here.)

Timeline for d1m4pa_: