Lineage for d1m4la_ (1m4l A:)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 246616Fold c.56: Phosphorylase/hydrolase-like [53162] (6 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 246767Superfamily c.56.5: Zn-dependent exopeptidases [53187] (5 families) (S)
    core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest
  5. 246768Family c.56.5.1: Pancreatic carboxypeptidases [53188] (3 proteins)
  6. 246769Protein Carboxypeptidase A [53189] (4 species)
  7. 246772Species Cow (Bos taurus) [TaxId:9913] [53190] (25 PDB entries)
  8. 246773Domain d1m4la_: 1m4l A: [78604]
    high resolution structure
    complexed with zn

Details for d1m4la_

PDB Entry: 1m4l (more details), 1.25 Å

PDB Description: structure of native carboxypeptidase a at 1.25 resolution

SCOP Domain Sequences for d1m4la_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m4la_ c.56.5.1 (A:) Carboxypeptidase A {Cow (Bos taurus)}
arstntfnyatyhtldeiydfmdllvaehpqlvsklqigrsyegrpiyvlkfstggsnrp
aiwidlgihsrewitqatgvwfakkftedygqdpsftaildsmdifleivtnpdgfafth
sqnrlwrktrsvtssslcvgvdanrnwdagfgkagassspcsetyhgkyansevevksiv
dfvkdhgnfkaflsihsysqlllypygyttqsipdktelnqvaksavaalkslygtsyky
gsiittiyqasggsidwsynqgikysftfelrdtgrygfllpasqiiptaqetwlgvlti
mehtvnn

SCOP Domain Coordinates for d1m4la_:

Click to download the PDB-style file with coordinates for d1m4la_.
(The format of our PDB-style files is described here.)

Timeline for d1m4la_: