| Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
| Fold d.109: Gelsolin-like [55752] (3 superfamilies) 3 layers: a/b/a; contains mixed beta-sheet |
Superfamily d.109.1: Actin depolymerizing proteins [55753] (3 families) ![]() |
| Family d.109.1.2: Cofilin-like [55762] (8 proteins) |
| Protein Adf-H domain of twinfilin isoform-1 [82752] (1 species) interacts only with G-actin |
| Species Mouse (Mus musculus) [TaxId:10090] [82753] (1 PDB entry) |
| Domain d1m4jb_: 1m4j B: [78603] |
PDB Entry: 1m4j (more details), 1.6 Å
SCOPe Domain Sequences for d1m4jb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1m4jb_ d.109.1.2 (B:) Adf-H domain of twinfilin isoform-1 {Mouse (Mus musculus) [TaxId: 10090]}
iqasedvkeifararngkyrllkisieneqlvvgscsppsdsweqdydsfvlplledkqp
cyvlfrldsqnaqgyewifiawspdhshvrqkmlyaatratlkkefggghikdevfgtvk
edvslhgykkyll
Timeline for d1m4jb_: