SCOP 1.75: Domain d1m4jb_: 1m4j B:

Lineage for d1m4jb_ (1m4j B:)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.109: Gelsolin-like [55752] (3 superfamilies)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.109.1: Actin depolymerizing proteins [55753] (2 families)

5. Family d.109.1.2: Cofilin-like [55762] (7 proteins)

6. Protein Adf-H domain of twinfilin isoform-1 [82752] (1 species)
   interacts only with G-actin

7. Species Mouse (Mus musculus) [TaxId:10090] [82753] (1 PDB entry)

8. Domain d1m4jb_: 1m4j B: [78603]

Details for d1m4jb_

PDB Entry: 1m4j, 1.6 Å

PDB Description: crystal structure of the n-terminal adf-h domain of mouse twinfilin isoform-1

PDB Compounds: (B:) A6 gene product

SCOP Domain Sequences for d1m4jb_:

Sequence; same for both SEQRES and ATOM records:

>d1m4jb_ d.109.1.2 (B:) Adf-H domain of twinfilin isoform-1 {Mouse (Mus musculus) [TaxId: 10090]}
iqasedvkeifararngkyrllkisieneqlvvgscsppsdsweqdydsfvlplledkqp
cyvlfrldsqnaqgyewifiawspdhshvrqkmlyaatratlkkefggghikdevfgtvk
edvslhgykkyll

Timeline for d1m4jb_:

• d1m4jb_ first appeared in SCOP 1.63
  
• d1m4jb_ appears in SCOP 1.73
  
• d1m4jb_ appears in SCOPe 2.01
  
• d1m4jb_ appears in the current release, SCOPe 2.08