Lineage for d1m4jb_ (1m4j B:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 609305Fold d.109: Gelsolin-like [55752] (2 superfamilies)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 609306Superfamily d.109.1: Actin depolymerizing proteins [55753] (2 families) (S)
  5. 609374Family d.109.1.2: Cofilin-like [55762] (7 proteins)
  6. 609375Protein Adf-H domain of twinfilin isoform-1 [82752] (1 species)
    interacts only with G-actin
  7. 609376Species Mouse (Mus musculus) [TaxId:10090] [82753] (1 PDB entry)
  8. 609378Domain d1m4jb_: 1m4j B: [78603]

Details for d1m4jb_

PDB Entry: 1m4j (more details), 1.6 Å

PDB Description: crystal structure of the n-terminal adf-h domain of mouse twinfilin isoform-1

SCOP Domain Sequences for d1m4jb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m4jb_ d.109.1.2 (B:) Adf-H domain of twinfilin isoform-1 {Mouse (Mus musculus)}
iqasedvkeifararngkyrllkisieneqlvvgscsppsdsweqdydsfvlplledkqp
cyvlfrldsqnaqgyewifiawspdhshvrqkmlyaatratlkkefggghikdevfgtvk
edvslhgykkyll

SCOP Domain Coordinates for d1m4jb_:

Click to download the PDB-style file with coordinates for d1m4jb_.
(The format of our PDB-style files is described here.)

Timeline for d1m4jb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1m4ja_