Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (24 families) "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
Family b.1.18.17: Copper resistance protein C (CopC, PcoC) [81969] (1 protein) automatically mapped to Pfam PF04234 automatically mapped to Pfam PF13205 |
Protein Copper resistance protein C (CopC, PcoC) [81970] (3 species) |
Species Pseudomonas syringae [TaxId:317] [81971] (4 PDB entries) |
Domain d1m42a_: 1m42 A: [78597] |
PDB Entry: 1m42 (more details)
SCOPe Domain Sequences for d1m42a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1m42a_ b.1.18.17 (A:) Copper resistance protein C (CopC, PcoC) {Pseudomonas syringae [TaxId: 317]} hpklvsstpaegsegaapakielhfsenlvtqfsgaklvmtampgmehspmavkaavsgg gdpktmvitpaspltagtykvdwravssdthpitgsvtfkvk
Timeline for d1m42a_: