Lineage for d1m41a_ (1m41 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2089162Superfamily c.1.16: Bacterial luciferase-like [51679] (5 families) (S)
    consists of clearly related families of somewhat different folds
  5. 2089206Family c.1.16.4: Ssud-like monoxygenases [82275] (2 protein domains)
  6. 2089207Protein Alkanesulfonate monooxygenase SsuD [82276] (1 species)
  7. 2089208Species Escherichia coli [TaxId:562] [82277] (2 PDB entries)
  8. 2089210Domain d1m41a_: 1m41 A: [78595]

Details for d1m41a_

PDB Entry: 1m41 (more details), 2.3 Å

PDB Description: Crystal structure of Escherichia coli alkanesulfonate monooxygenase SsuD at 2.3 A resolution
PDB Compounds: (A:) FMNH2-dependent alkanesulfonate monooxygenase

SCOPe Domain Sequences for d1m41a_:

Sequence, based on SEQRES records: (download)

>d1m41a_ c.1.16.4 (A:) Alkanesulfonate monooxygenase SsuD {Escherichia coli [TaxId: 562]}
slnmfwflpthgdghylgteegsrpvdhgylqqiaqaadrlgytgvliptgrscedawlv
aasmipvtqrlkflvalrpsvtsptvaarqaatldrlsngralfnlvtgsdpqelagdgv
fldhseryeasaeftqvwrrllqretvdfngkhihvrgakllfpaiqqpypplyfggssd
vaqelaaeqvdlyltwgeppelvkekieqvrakaaahgrkirfgirlhvivretndeawq
aaerlishlddetiakaqaafartdsvgqqrmaalhngkrdnleispnlwagvglvrgga
gtalvgdgptvaarineyaalgidsfvlsgyphleeayrvgellfplldvaipeipqpqp
l

Sequence, based on observed residues (ATOM records): (download)

>d1m41a_ c.1.16.4 (A:) Alkanesulfonate monooxygenase SsuD {Escherichia coli [TaxId: 562]}
slnmfwflpthgdghylgteegsrpvdhgylqqiaqaadrlgytgvliptgrscedawlv
aasmipvtqrlkflvalrpsvtsptvaarqaatldrlsngralfnlvtgsdpqelagdgv
fldhseryeasaeftqvwrrllqretvdfngkhihvrgakllfpaiqqpypplyfggssd
vaqelaaeqvdlyltwgeppelvkekieqvrakaaahgrkirfgirlhvivretndeawq
aaerlishlleispnlwagvglvrggagtalvgdgptvaarineyaalgidsfvlsgyph
leeayrvgellfplldvaipeipqpqpl

SCOPe Domain Coordinates for d1m41a_:

Click to download the PDB-style file with coordinates for d1m41a_.
(The format of our PDB-style files is described here.)

Timeline for d1m41a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1m41b_