Lineage for d1m3yc1 (1m3y C:25-221)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1812227Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 1812279Superfamily b.121.2: Group II dsDNA viruses VP [49749] (4 families) (S)
    duplication: consists of two domains of this fold packed together like the nucleoplasmin subunits
    trimeric; in the trimers, the domains are arranged around pseudo six-fold axis
  5. 1812335Family b.121.2.3: Major capsid protein vp54 [82013] (1 protein)
  6. 1812336Protein Major capsid protein vp54 [82014] (1 species)
  7. 1812337Species Paramecium bursaria chlorella virus 1, PBCV-1 [TaxId:10506] [82015] (2 PDB entries)
    a large, lipid-containing, DNA virus
  8. 1812342Domain d1m3yc1: 1m3y C:25-221 [78583]
    complexed with hg, man, nag, ndg

Details for d1m3yc1

PDB Entry: 1m3y (more details), 2 Å

PDB Description: the structure of major capsid protein of a large, lipid containing, dna virus
PDB Compounds: (C:) The Major capsid protein of PBCV-1, Vp54

SCOPe Domain Sequences for d1m3yc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m3yc1 b.121.2.3 (C:25-221) Major capsid protein vp54 {Paramecium bursaria chlorella virus 1, PBCV-1 [TaxId: 10506]}
tffktvyrrytnfaiesiqqtingsvgfgnkvstqisrngdlitdivvefvltkggnggt
tyypaeellqdveleiggqridkhyndwfrtydalfrmnddrynyrrmtdwvnnelvgaq
krfyvplifffnqtpglalplialqyhevklyftlasqvqgvnyngssaiagaaqptmsv
wvdyifldtqertrfaq

SCOPe Domain Coordinates for d1m3yc1:

Click to download the PDB-style file with coordinates for d1m3yc1.
(The format of our PDB-style files is described here.)

Timeline for d1m3yc1: