Lineage for d1m3sb1 (1m3s B:1-185)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2140243Fold c.80: SIS domain [53696] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 21345
  4. 2140244Superfamily c.80.1: SIS domain [53697] (4 families) (S)
  5. 2140400Family c.80.1.3: mono-SIS domain [69599] (6 protein domains)
    dimer of mono-domain subunits
  6. 2140410Protein Hypothetical protein YckF [82534] (1 species)
  7. 2140411Species Bacillus subtilis [TaxId:1423] [82535] (2 PDB entries)
  8. 2140413Domain d1m3sb1: 1m3s B:1-185 [78574]
    Other proteins in same PDB: d1m3sa2, d1m3sb2
    structural genomics
    CASP5

Details for d1m3sb1

PDB Entry: 1m3s (more details), 1.95 Å

PDB Description: crystal structure of yckf from bacillus subtilis
PDB Compounds: (B:) Hypothetical protein yckf

SCOPe Domain Sequences for d1m3sb1:

Sequence, based on SEQRES records: (download)

>d1m3sb1 c.80.1.3 (B:1-185) Hypothetical protein YckF {Bacillus subtilis [TaxId: 1423]}
mktteyvaeilnelhnsaayisneeadqladhilsshqiftagagrsglmaksfamrlmh
mgfnahivgeiltpplaegdlviigsgsgetkslihtaakakslhgivaaltinpessig
kqadliirmpgspkdqsngsyktiqpmgslfeqtlllfydavilklmekkgldsetmfth
hanle

Sequence, based on observed residues (ATOM records): (download)

>d1m3sb1 c.80.1.3 (B:1-185) Hypothetical protein YckF {Bacillus subtilis [TaxId: 1423]}
mktteyvaeilnelhnsaayisneeadqladhilsshqiftagagrsglmaksfamrlmh
mgfnahivgeiltpplaegdlviigsgsgetkslihtaakakslhgivaaltinpessig
kqadliirmpgspkdqsngsyktiqpmgslfeqtlllfydavilklmekkgltmfthhan
le

SCOPe Domain Coordinates for d1m3sb1:

Click to download the PDB-style file with coordinates for d1m3sb1.
(The format of our PDB-style files is described here.)

Timeline for d1m3sb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1m3sb2