SCOPe 2.07: Domain d1m3sa1: 1m3s A:1-185

Lineage for d1m3sa1 (1m3s A:1-185)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.80: SIS domain [53696] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 5 strands, order 21345

4. Superfamily c.80.1: SIS domain [53697] (4 families)

5. Family c.80.1.3: mono-SIS domain [69599] (6 proteins)
   dimer of mono-domain subunits

6. Protein Hypothetical protein YckF [82534] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [82535] (2 PDB entries)

8. Domain d1m3sa1: 1m3s A:1-185 [78573]
   Other proteins in same PDB: d1m3sa2, d1m3sb2
   structural genomics
   CASP5

Details for d1m3sa1

PDB Entry: 1m3s, 1.95 Å

PDB Description: crystal structure of yckf from bacillus subtilis

PDB Compounds: (A:) Hypothetical protein yckf

SCOPe Domain Sequences for d1m3sa1:

Sequence, based on SEQRES records:

>d1m3sa1 c.80.1.3 (A:1-185) Hypothetical protein YckF {Bacillus subtilis [TaxId: 1423]}
mktteyvaeilnelhnsaayisneeadqladhilsshqiftagagrsglmaksfamrlmh
mgfnahivgeiltpplaegdlviigsgsgetkslihtaakakslhgivaaltinpessig
kqadliirmpgspkdqsngsyktiqpmgslfeqtlllfydavilklmekkgldsetmfth
hanle

Sequence, based on observed residues (ATOM records):

>d1m3sa1 c.80.1.3 (A:1-185) Hypothetical protein YckF {Bacillus subtilis [TaxId: 1423]}
mktteyvaeilnelhnsaayisneeadqladhilsshqiftagagrsglmaksfamrlmh
mgfnahivgeiltpplaegdlviigsgsgetkslihtaakakslhgivaaltinpessig
kqadliirmpgspkdyktiqpmgslfeqtlllfydavilklmekkgldsetmfthhanle

Timeline for d1m3sa1:

• d1m3sa1 first appeared in SCOP 1.63, called d1m3sa_
  
• d1m3sa1 appears in SCOPe 2.06
  
• d1m3sa1 appears in the current release, SCOPe 2.08