Lineage for d1m3sa_ (1m3s A:)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 249876Fold c.80: SIS domain [53696] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 21345
  4. 249877Superfamily c.80.1: SIS domain [53697] (3 families) (S)
  5. 249926Family c.80.1.3: mono-SIS domain [69599] (2 proteins)
    dimer of mono-domain subunits
  6. 249927Protein Hypothetical protein YckF [82534] (1 species)
  7. 249928Species Bacillus subtilis [TaxId:1423] [82535] (1 PDB entry)
  8. 249929Domain d1m3sa_: 1m3s A: [78573]

Details for d1m3sa_

PDB Entry: 1m3s (more details), 1.95 Å

PDB Description: crystal structure of yckf from bacillus subtilis

SCOP Domain Sequences for d1m3sa_:

Sequence, based on SEQRES records: (download)

>d1m3sa_ c.80.1.3 (A:) Hypothetical protein YckF {Bacillus subtilis}
gmktteyvaeilnelhnsaayisneeadqladhilsshqiftagagrsglmaksfamrlm
hmgfnahivgeiltpplaegdlviigsgsgetkslihtaakakslhgivaaltinpessi
gkqadliirmpgspkdqsngsyktiqpmgslfeqtlllfydavilklmekkgldsetmft
hhanle

Sequence, based on observed residues (ATOM records): (download)

>d1m3sa_ c.80.1.3 (A:) Hypothetical protein YckF {Bacillus subtilis}
gmktteyvaeilnelhnsaayisneeadqladhilsshqiftagagrsglmaksfamrlm
hmgfnahivgeiltpplaegdlviigsgsgetkslihtaakakslhgivaaltinpessi
gkqadliirmpgspkdyktiqpmgslfeqtlllfydavilklmekkgldsetmfthhanl
e

SCOP Domain Coordinates for d1m3sa_:

Click to download the PDB-style file with coordinates for d1m3sa_.
(The format of our PDB-style files is described here.)

Timeline for d1m3sa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1m3sb_