Lineage for d1m3kd1 (1m3k D:1-268)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 403921Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 403922Superfamily c.95.1: Thiolase-like [53901] (2 families) (S)
  5. 403923Family c.95.1.1: Thiolase-related [53902] (6 proteins)
  6. 404023Protein Biosynthetic thiolase [53905] (1 species)
  7. 404024Species Zoogloea ramigera [TaxId:350] [53906] (11 PDB entries)
  8. 404031Domain d1m3kd1: 1m3k D:1-268 [78571]

Details for d1m3kd1

PDB Entry: 1m3k (more details), 1.7 Å

PDB Description: biosynthetic thiolase, inactive c89a mutant

SCOP Domain Sequences for d1m3kd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m3kd1 c.95.1.1 (D:1-268) Biosynthetic thiolase {Zoogloea ramigera}
stpsiviasaartavgsfngafantpahelgatvisavleragvaagevnevilgqvlpa
gegqnparqaamkagvpqeatawgmnqlagsglravalgmqqiatgdasiivaggmesms
maphcahlrggvkmgdfkmidtmikdgltdafygyhmgttaenvakqwqlsrdeqdafav
asqnkaeaaqkdgrfkdeivpfivkgrkgditvdadeyirhgatldsmaklrpafdkegt
vtagnasglndgaaaallmseaeasrrg

SCOP Domain Coordinates for d1m3kd1:

Click to download the PDB-style file with coordinates for d1m3kd1.
(The format of our PDB-style files is described here.)

Timeline for d1m3kd1: