SCOPe 2.08: Domain d1m3kc2: 1m3k C:269-392

Lineage for d1m3kc2 (1m3k C:269-392)

Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

Fold c.95: Thiolase-like [53900] (1 superfamily)
consists of two similar domains related by pseudo dyad; duplication
3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

Superfamily c.95.1: Thiolase-like [53901] (3 families)
Family c.95.1.1: Thiolase-related [53902] (20 proteins)
Protein Biosynthetic thiolase, C-terminal domain [419021] (1 species)
Species Zoogloea ramigera [TaxId:350] [419503] (16 PDB entries)
Uniprot P07097
Domain d1m3kc2: 1m3k C:269-392 [78570]
Other proteins in same PDB: d1m3ka1, d1m3kb1, d1m3kc1, d1m3kd1
complexed with gol, so4; mutant

Details for d1m3kc2

PDB Entry: 1m3k (more details), 1.7 Å

PDB Description: biosynthetic thiolase, inactive c89a mutant

PDB Compounds: (C:) Acetyl-CoA acetyltransferase

SCOPe Domain Sequences for d1m3kc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m3kc2 c.95.1.1 (C:269-392) Biosynthetic thiolase, C-terminal domain {Zoogloea ramigera [TaxId: 350]}
iqplgrivswatvgvdpkvmgtgpipasrkaleragwkigdldlveaneafaaqacavnk
dlgwdpsivnvnggaiaighpigasgarilntllfemkrrgarkglatlcigggmgvamc
iesl

SCOPe Domain Coordinates for d1m3kc2:

Click to download the PDB-style file with coordinates for d1m3kc2.
(The format of our PDB-style files is described here.)

Timeline for d1m3kc2: