Lineage for d1m3kb1 (1m3k B:1-268)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 322246Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strands 1 & 5 are antiparallel to the rest
  4. 322247Superfamily c.95.1: Thiolase-like [53901] (2 families) (S)
  5. 322248Family c.95.1.1: Thiolase-related [53902] (6 proteins)
  6. 322324Protein Biosynthetic thiolase [53905] (1 species)
  7. 322325Species Zoogloea ramigera [TaxId:350] [53906] (10 PDB entries)
  8. 322328Domain d1m3kb1: 1m3k B:1-268 [78567]

Details for d1m3kb1

PDB Entry: 1m3k (more details), 1.7 Å

PDB Description: biosynthetic thiolase, inactive c89a mutant

SCOP Domain Sequences for d1m3kb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m3kb1 c.95.1.1 (B:1-268) Biosynthetic thiolase {Zoogloea ramigera}
stpsiviasaartavgsfngafantpahelgatvisavleragvaagevnevilgqvlpa
gegqnparqaamkagvpqeatawgmnqlagsglravalgmqqiatgdasiivaggmesms
maphcahlrggvkmgdfkmidtmikdgltdafygyhmgttaenvakqwqlsrdeqdafav
asqnkaeaaqkdgrfkdeivpfivkgrkgditvdadeyirhgatldsmaklrpafdkegt
vtagnasglndgaaaallmseaeasrrg

SCOP Domain Coordinates for d1m3kb1:

Click to download the PDB-style file with coordinates for d1m3kb1.
(The format of our PDB-style files is described here.)

Timeline for d1m3kb1: