Lineage for d1m3ea2 (1m3e A:260-481)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 247467Fold c.63: CoA transferase [53315] (1 superfamily)
    core: 3 layers: a/b/a; beta-sheet of 7 strands, order 4321567; part of sheet is folded upon itself and forms a barrel-like structure
  4. 247468Superfamily c.63.1: CoA transferase [53316] (2 families) (S)
  5. 247488Family c.63.1.3: beta subunit-like [74657] (2 protein domains)
    mixed beta-sheet; strand 3 is antiparallel to the rest
  6. 247493Protein Succinate:CoA transferase, C-terminal domain [82466] (1 species)
  7. 247494Species Pig (Sus scrofa) [TaxId:9823] [82467] (2 PDB entries)
  8. 247495Domain d1m3ea2: 1m3e A:260-481 [78558]
    Other proteins in same PDB: d1m3ea1, d1m3eb1, d1m3ec1, d1m3ed1

Details for d1m3ea2

PDB Entry: 1m3e (more details), 2.5 Å

PDB Description: succinyl-coa:3-ketoacid coa transferase from pig heart (selenomethionine)

SCOP Domain Sequences for d1m3ea2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m3ea2 c.63.1.3 (A:260-481) Succinate:CoA transferase, C-terminal domain {Pig (Sus scrofa)}
dnvreriikraalefedgmyanlgigipllasnfispnmtvhlqsengilglgpyplqne
vdadlinagketvtvlpgasyfssdesfamirgghvnltmlgamqvskygdlanwmipgk
lvkgmggamdlvssaktkvvvtmehsakgnahkimekctlpltgkqcvnriitekavfdv
drkkgltlielwegltvddikkstgcdfavspklipmqqvtt

SCOP Domain Coordinates for d1m3ea2:

Click to download the PDB-style file with coordinates for d1m3ea2.
(The format of our PDB-style files is described here.)

Timeline for d1m3ea2: