| Class d: Alpha and beta proteins (a+b) [53931] (224 folds) |
| Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
Superfamily d.169.1: C-type lectin-like [56436] (6 families) ![]() |
| Family d.169.1.6: Noncollagenous (NC1) domain of collagen IV [75585] (1 protein) duplication: consists of two subdomains of this fold; segment swapping within and between individual domains |
| Protein Noncollagenous (NC1) domain of collagen IV [75586] (2 species) |
| Species Cow (Bos taurus) [TaxId:9913] [82820] (1 PDB entry) |
| Domain d1m3dl2: 1m3d L:115-226 [78556] alpha 1 (chains A,B,D,E,G,H,J and K) and alpha 2 (chains C,F,I and L) isoforms complexed with br, gol, lu |
PDB Entry: 1m3d (more details), 2 Å
SCOP Domain Sequences for d1m3dl2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1m3dl2 d.169.1.6 (L:115-226) Noncollagenous (NC1) domain of collagen IV {Cow (Bos taurus)}
iavhsqdvsiphcpagwrslwigysflmhtaagdegggqslvspgscledfratpfiecn
gargtchyyankysfwlttipeqsfqgtpsadtlkaglirthisrcqvcmkn
Timeline for d1m3dl2: