Lineage for d1m3di1 (1m3d I:5-114)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 264459Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 264460Superfamily d.169.1: C-type lectin-like [56436] (6 families) (S)
  5. 264733Family d.169.1.6: Noncollagenous (NC1) domain of collagen IV [75585] (1 protein)
    duplication: consists of two subdomains of this fold; segment swapping within and between individual domains
  6. 264734Protein Noncollagenous (NC1) domain of collagen IV [75586] (2 species)
  7. 264735Species Cow (Bos taurus) [TaxId:9913] [82820] (1 PDB entry)
  8. 264752Domain d1m3di1: 1m3d I:5-114 [78549]

Details for d1m3di1

PDB Entry: 1m3d (more details), 2 Å

PDB Description: Structure of Type IV Collagen NC1 Domains

SCOP Domain Sequences for d1m3di1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m3di1 d.169.1.6 (I:5-114) Noncollagenous (NC1) domain of collagen IV {Cow (Bos taurus)}
yllvkhsqtdqepmcpvgmnklwsgysllyfegqekahnqdlglagsclarfstmpflyc
npgdvcyyasrndksywlsttaplpmmpvaeedirpyisrcsvceapava

SCOP Domain Coordinates for d1m3di1:

Click to download the PDB-style file with coordinates for d1m3di1.
(The format of our PDB-style files is described here.)

Timeline for d1m3di1: