SCOP 1.63: Domain d1m3dg2: 1m3d G:115-228

Lineage for d1m3dg2 (1m3d G:115-228)

1. Root: SCOP 1.63

2. Class d: Alpha and beta proteins (a+b) [53931] (224 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (6 families)

5. Family d.169.1.6: Noncollagenous (NC1) domain of collagen IV [75585] (1 protein)
   duplication: consists of two subdomains of this fold; segment swapping within and between individual domains

6. Protein Noncollagenous (NC1) domain of collagen IV [75586] (2 species)

7. Species Cow (Bos taurus) [TaxId:9913] [82820] (1 PDB entry)

8. Domain d1m3dg2: 1m3d G:115-228 [78546]

Details for d1m3dg2

PDB Entry: 1m3d, 2 Å

PDB Description: Structure of Type IV Collagen NC1 Domains

SCOP Domain Sequences for d1m3dg2:

Sequence; same for both SEQRES and ATOM records:

>d1m3dg2 d.169.1.6 (G:115-228) Noncollagenous (NC1) domain of collagen IV {Cow (Bos taurus)}
amvmavhsqtiqipqcptgwsslwigysfvmhtsagaegsgqalaspgscleefrsapfi
echgrgtcnyyanaysfwlatiersemfkkptpstlkagelrthvsrcqvcmrr

Timeline for d1m3dg2:

• d1m3dg2 is new in SCOP 1.63
  
• d1m3dg2 appears in SCOP 1.65
  
• d1m3dg2 appears in the current release, SCOPe 2.08