Lineage for d1m3dg1 (1m3d G:4-114)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2234637Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 2234638Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 2235273Family d.169.1.6: Noncollagenous (NC1) domain of collagen IV [75585] (1 protein)
    duplication: consists of two subdomains of this fold; segment swapping within and between individual domains
    automatically mapped to Pfam PF01413
  6. 2235274Protein Noncollagenous (NC1) domain of collagen IV [75586] (2 species)
  7. 2235275Species Cow (Bos taurus) [TaxId:9913] [82820] (3 PDB entries)
    Uniprot P02462 1445-1667
  8. 2235348Domain d1m3dg1: 1m3d G:4-114 [78545]
    alpha 1 (chains A,B,D,E,G,H,J and K) and alpha 2 (chains C,F,I and L) isoforms
    complexed with br, gol, lu

Details for d1m3dg1

PDB Entry: 1m3d (more details), 2 Å

PDB Description: Structure of Type IV Collagen NC1 Domains
PDB Compounds: (G:) Type IV Collagen Noncollagenous Domain- Alpha1

SCOPe Domain Sequences for d1m3dg1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m3dg1 d.169.1.6 (G:4-114) Noncollagenous (NC1) domain of collagen IV {Cow (Bos taurus) [TaxId: 9913]}
hgflvtrhsqttddpqcppgtkilyhgysllyvqgnerahgqdlgtagsclrkfstmpfl
fcninnvcnfasrndysywlstpepmpmsmapitgenirpfisrcavceap

SCOPe Domain Coordinates for d1m3dg1:

Click to download the PDB-style file with coordinates for d1m3dg1.
(The format of our PDB-style files is described here.)

Timeline for d1m3dg1: