![]() | Class d: Alpha and beta proteins (a+b) [53931] (224 folds) |
![]() | Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
![]() | Superfamily d.169.1: C-type lectin-like [56436] (6 families) ![]() |
![]() | Family d.169.1.6: Noncollagenous (NC1) domain of collagen IV [75585] (1 protein) duplication: consists of two subdomains of this fold; segment swapping within and between individual domains |
![]() | Protein Noncollagenous (NC1) domain of collagen IV [75586] (2 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [82820] (1 PDB entry) |
![]() | Domain d1m3db1: 1m3d B:6-114 [78535] |
PDB Entry: 1m3d (more details), 2 Å
SCOP Domain Sequences for d1m3db1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1m3db1 d.169.1.6 (B:6-114) Noncollagenous (NC1) domain of collagen IV {Cow (Bos taurus)} flvtrhsqttddpqcppgtkilyhgysllyvqgnerahgqdlgtagsclrkfstmpflfc ninnvcnfasrndysywlstpepmpmsmapitgenirpfisrcavceap
Timeline for d1m3db1: