![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
![]() | Superfamily d.169.1: C-type lectin-like [56436] (9 families) ![]() |
![]() | Family d.169.1.6: Noncollagenous (NC1) domain of collagen IV [75585] (2 proteins) duplication: consists of two subdomains of this fold; segment swapping within and between individual domains automatically mapped to Pfam PF01413 |
![]() | Protein Noncollagenous (NC1) domain of collagen IV [75586] (2 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [82820] (3 PDB entries) Uniprot P02462 1445-1667 |
![]() | Domain d1m3db1: 1m3d B:6-114 [78535] alpha 1 (chains A,B,D,E,G,H,J and K) and alpha 2 (chains C,F,I and L) isoforms complexed with br, gol, lu |
PDB Entry: 1m3d (more details), 2 Å
SCOPe Domain Sequences for d1m3db1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1m3db1 d.169.1.6 (B:6-114) Noncollagenous (NC1) domain of collagen IV {Cow (Bos taurus) [TaxId: 9913]} flvtrhsqttddpqcppgtkilyhgysllyvqgnerahgqdlgtagsclrkfstmpflfc ninnvcnfasrndysywlstpepmpmsmapitgenirpfisrcavceap
Timeline for d1m3db1: