Lineage for d1m38b_ (1m38 B:)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 228551Fold b.40: OB-fold [50198] (9 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 229472Superfamily b.40.5: Inorganic pyrophosphatase [50324] (1 family) (S)
  5. 229473Family b.40.5.1: Inorganic pyrophosphatase [50325] (1 protein)
    barrel, closed; n=5, S=8
  6. 229474Protein Inorganic pyrophosphatase [50326] (4 species)
    eukaryotic enzyme has additional secondary structures at both N- and C-termini
  7. 229482Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [50327] (11 PDB entries)
  8. 229488Domain d1m38b_: 1m38 B: [78532]
    complexed with co, po4

Details for d1m38b_

PDB Entry: 1m38 (more details), 1.8 Å

PDB Description: Structure of Inorganic Pyrophosphatase

SCOP Domain Sequences for d1m38b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m38b_ b.40.5.1 (B:) Inorganic pyrophosphatase {Baker's yeast (Saccharomyces cerevisiae)}
tyttrqigakntleykvyiekdgkpvsafhdiplyadkennifnmvveiprwtnakleit
keetlnpiiqdtkkgklrfvrncfphhgyihnygafpqtwedpnvshpetkavgdndpid
vleigetiaytgqvkqvkalgimalldegetdwkviaidindplapklndiedvekyfpg
llratnewfriykipdgkpenqfafsgeaknkkyaldiikethdswkqliagkssdskgi
dltnvtlpdtptyskaasdaippaspkadapidksidkwffi

SCOP Domain Coordinates for d1m38b_:

Click to download the PDB-style file with coordinates for d1m38b_.
(The format of our PDB-style files is described here.)

Timeline for d1m38b_: